PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G222700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 619aa    MW: 68734.8 Da    PI: 7.8817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G222700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-1568114148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT +Ede+l +av    g++Wk+Ia+ ++  Rt  qc +rwqk+l
  Sevir.3G222700.1.p  68 KGGWTLDEDEKLRKAVGACNGKNWKKIAESFP-DRTSVQCLHRWQKVL 114
                         688*****************************.************986 PP

2Myb_DNA-binding59.76.6e-19120166148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd+++++ vk++G++ W++Iar +  gR +kqc++rw+++l
  Sevir.3G222700.1.p 120 KGPWTQEEDDIIINMVKKYGPKKWSLIARSLD-GRIGKQCRERWHNHL 166
                         79******************************.*************97 PP

3Myb_DNA-binding53.55.4e-17172215146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         + +W+ eE+   +da++++G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.3G222700.1.p 172 KEAWSVEEERVVADAHRLHGNK-WAEIAKLLP-GRTDNSIKNHWNS 215
                         579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.20863114IPR017930Myb domain
SMARTSM007171.6E-1367116IPR001005SANT/Myb domain
PfamPF002491.9E-1368114IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-1569124IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-2370125IPR009057Homeodomain-like
CDDcd001671.36E-1171114No hitNo description
PROSITE profilePS5129431.769115170IPR017930Myb domain
SuperFamilySSF466898.61E-31117213IPR009057Homeodomain-like
SMARTSM007171.2E-17119168IPR001005SANT/Myb domain
PfamPF002497.0E-17120166IPR001005SANT/Myb domain
CDDcd001672.18E-15122166No hitNo description
Gene3DG3DSA:1.10.10.605.8E-26126170IPR009057Homeodomain-like
PROSITE profilePS5129420.697171221IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-21171221IPR009057Homeodomain-like
SMARTSM007177.0E-15171219IPR001005SANT/Myb domain
PfamPF002493.7E-15172215IPR001005SANT/Myb domain
CDDcd001672.63E-11174217No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MGAMAAVKVE EPEGSTGNWW NLAASSPSPS VSEAGSYGGG ALMSPVESNP ADSVSGRRRT  60
SGPVRRAKGG WTLDEDEKLR KAVGACNGKN WKKIAESFPD RTSVQCLHRW QKVLNPELIK  120
GPWTQEEDDI IINMVKKYGP KKWSLIARSL DGRIGKQCRE RWHNHLDPQI IKEAWSVEEE  180
RVVADAHRLH GNKWAEIAKL LPGRTDNSIK NHWNSSLRKR LGDYNASRAL PVSVHMVHNS  240
FKHEKAKLSG GNHIDLNKEP NINLERPPEI VDHSEHATHL HACSLKNIKS CSDFLSLAMP  300
TAQPKKLCEM FGGGYSAVAL AGIQGLKMDF VHDKGTEINV VCKERLKNDL LNVEVRKLDH  360
ATDTIGYSGS AKVEGKTVNN MCKLFLPNES NSFGSLCYEI PKLEDVVPCH SPVFSTPHIQ  420
QCCEDGFLPP VGYTTSSRDG DISDQLSVES ILKSAAENFP GTPSILRRRK RETPAHDEDS  480
NLKIAILHSN SFHTPLGKCT TESPHSFKTA SFLSLGPPDN EGLSATLGSF DVSPPYRLRS  540
KRMAILKTVE KKHLNFSSDE MDNYDSPDTM KKYSSWKTEC TNTYTDVSSK QEMKMTEHMV  600
DLETLAKDFT HTTKLDLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-69672215159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-69672215159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961857.10.0PREDICTED: myb-related protein A-like
RefseqXP_014660295.10.0PREDICTED: myb-related protein A-like
TrEMBLK3Z4L60.0K3Z4L6_SETIT; Uncharacterized protein
STRINGSi021484m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.26e-93myb domain protein 3r-5